PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015888719.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family LBD
Protein Properties Length: 196aa    MW: 21979.9 Da    PI: 6.2488
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015888719.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260116.22.1e-36211183100
          DUF260   3 aaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelall 97 
                     aaCk+lrrkC ++C l+pyfp+e+ +kfa vh++FGasnv+k+++ ++e +red++++lvyeA ar+rdPvyG+ g i++lq+ +e+l ++l+++
  XP_015888719.1  21 AACKMLRRKCDSNCLLSPYFPSEDIEKFAGVHRVFGASNVVKMIQMVEEANREDTVKALVYEATARLRDPVYGSSGAIFHLQKMVEELTSQLETV 115
                     8*******************************************************************************************998 PP

          DUF260  98 kee 100
                      ++
  XP_015888719.1 116 TAQ 118
                     876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.05518119IPR004883Lateral organ boundaries, LOB
PfamPF031952.9E-3621115IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 196 aa     Download sequence    Send to blast
METTQVPMPG GGGRGVHIPY AACKMLRRKC DSNCLLSPYF PSEDIEKFAG VHRVFGASNV  60
VKMIQMVEEA NREDTVKALV YEATARLRDP VYGSSGAIFH LQKMVEELTS QLETVTAQAS  120
ELQANIDQLL SILMNVGYLD IFSTMHHHPS TFDDDCTHHL LQHHHHHQHN IIPDTVASCD  180
IIPDDHHLIN VPKDHN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015888719.11e-146PREDICTED: LOB domain-containing protein 25-like
SwissprotQ9LQR09e-40LBD1_ARATH; LOB domain-containing protein 1
TrEMBLM5XHG32e-67M5XHG3_PRUPE; Uncharacterized protein
STRINGPOPTR_0014s16510.11e-60(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF140681921
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.16e-41LOB domain-containing protein 1